PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g07160
Common NameGSCOC_T00030141001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family NF-YC
Protein Properties Length: 280aa    MW: 30852.3 Da    PI: 4.8839
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g07160genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC60.82.9e-196861898
        NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                 ++++P +rikki++adedv +i+  +P l+ska elf+ +l  r++  +     +t++   ++++v++ ++fdfl div r
  Cc01_g07160  6 DTRFPASRIKKIMQADEDVGKIAMAVPLLVSKALELFLQDLCDRTYEITLRRGAKTVNSLHLKQCVQSFNVFDFLRDIVSR 86
                 5789**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-25372IPR009072Histone-fold
SuperFamilySSF471136.92E-20488IPR009072Histone-fold
PfamPF008081.1E-18871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MRKKLDTRFP ASRIKKIMQA DEDVGKIAMA VPLLVSKALE LFLQDLCDRT YEITLRRGAK  60
TVNSLHLKQC VQSFNVFDFL RDIVSRVPDL GGSEAAAEGS SARKRKAIED EGNDSDNEAK  120
KSHVSETGHT SGRGRGRGRG RGRGRANRTL EKESISQCEK YEDDLDISLQ NGDKKSINIK  180
RMDNGANPDD TKISLVAQNA EAPVRNFDLN VDLNENADSG AIPAGTPSTS SAKPPMEVRP  240
EEYPGWSLAD MESMAIDPVQ LAKLNQRIEE EEEDYDEEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-22272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134144RGRGRGRGRGR
2136145RGRGRGRGRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002268866.11e-104PREDICTED: dr1-associated corepressor isoform X2
TrEMBLA0A068UMH50.0A0A068UMH5_COFCA; Uncharacterized protein
STRINGVIT_06s0009g02120.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA75552029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.19e-61nuclear factor Y, subunit C11